(data stored in ACNUC7421 zone)

EMBL: CP001115.PE59

CP001115.PE59        Location/Qualifiers
FT   CDS             complement(84175..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00490"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47449"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C1D210"
FT                   /protein_id="ACO47449.1"
FT                   /translation="MNASKNNDLSDQARKDALRAMLLRLISDGQLTDEELRLLIRTRNA
FT                   LDLSPEEVRSLRAEIYQAALQRAQQDGHIGGREAELLDRIVQFLNGGAWLTEHFE"
     MNASKNNDLS DQARKDALRA MLLRLISDGQ LTDEELRLLI RTRNALDLSP EEVRSLRAEI        60
     YQAALQRAQQ DGHIGGREAE LLDRIVQFLN GGAWLTEHFE                             100
//

If you have problems or comments...

PBIL Back to PBIL home page