(data stored in ACNUC7421 zone)

EMBL: CP001115.PE6

CP001115.PE6         Location/Qualifiers
FT   CDS             complement(4713..5042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47395"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V6"
FT                   /protein_id="ACO47395.1"
FT                   /translation="MHMQNIPFGTTDWAAVEETTHPGEQGVAYWRTRLFGDIRVRRVQY
FT                   VAGYVADHWCTKGHILLVLDGQLETTLEDGRSFTLTAGMSYQVADGAEAHRSSAPQGAT
FT                   LFIVD"
     MHMQNIPFGT TDWAAVEETT HPGEQGVAYW RTRLFGDIRV RRVQYVAGYV ADHWCTKGHI        60
     LLVLDGQLET TLEDGRSFTL TAGMSYQVAD GAEAHRSSAP QGATLFIVD                   109
//

If you have problems or comments...

PBIL Back to PBIL home page