(data stored in ACNUC7421 zone)

EMBL: CP001115.PE60

CP001115.PE60        Location/Qualifiers
FT   CDS             complement(84518..84991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00500"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47450"
FT                   /db_xref="UniProtKB/TrEMBL:C1D211"
FT                   /protein_id="ACO47450.1"
FT                   /translation="MKPMLSCLLLTLALPSCAPANSVPSIPASIGLVCTGSSMGTLTRA
FT                   DSELSLVVNRAGEVSGSFTNNGTVFAAQGKAAVREDQRTLVVSQLSLSLDSTVEGRAGI
FT                   TASMGAVRTGVGLTGRLGSNGNLNGTLDAHGRFAGTFRGVQGTYRTLMNCGVN"
     MKPMLSCLLL TLALPSCAPA NSVPSIPASI GLVCTGSSMG TLTRADSELS LVVNRAGEVS        60
     GSFTNNGTVF AAQGKAAVRE DQRTLVVSQL SLSLDSTVEG RAGITASMGA VRTGVGLTGR       120
     LGSNGNLNGT LDAHGRFAGT FRGVQGTYRT LMNCGVN                                157
//

If you have problems or comments...

PBIL Back to PBIL home page