(data stored in ACNUC7421 zone)

EMBL: CP001115.PE62

CP001115.PE62        Location/Qualifiers
FT   CDS             complement(86708..87061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00503"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00503"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47453"
FT                   /db_xref="UniProtKB/TrEMBL:C1D214"
FT                   /protein_id="ACO47453.1"
FT                   /translation="MTPLPGTCFGSQNSAVRTLVVPQGRATKGCLSISPLPDAEIKAAR
FT                   LRSGAQNCGGVQSHPSLRSRNFDVLLTGCPWEVSGSLTWGYRATRMTSASPHQTDVNRT
FT                   PNRPVAVTSAAMP"
     MTPLPGTCFG SQNSAVRTLV VPQGRATKGC LSISPLPDAE IKAARLRSGA QNCGGVQSHP        60
     SLRSRNFDVL LTGCPWEVSG SLTWGYRATR MTSASPHQTD VNRTPNRPVA VTSAAMP          117
//

If you have problems or comments...

PBIL Back to PBIL home page