(data stored in ACNUC7421 zone)

EMBL: CP001115.PE65

CP001115.PE65        Location/Qualifiers
FT   CDS             complement(88657..88884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00514"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26546"
FT                   /db_xref="UniProtKB/TrEMBL:X5HLJ4"
FT                   /protein_id="AHX26546.1"
FT                   /translation="MTASVSVTCSWVPGTLDRIRVTCAQHDEVWHIRDVANRYGREALN
FT                   ALYLKGRYQTHVSRRELLAFPFIARTEPKS"
     MTASVSVTCS WVPGTLDRIR VTCAQHDEVW HIRDVANRYG REALNALYLK GRYQTHVSRR        60
     ELLAFPFIAR TEPKS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page