(data stored in ACNUC7421 zone)

EMBL: CP001115.PE67

CP001115.PE67        Location/Qualifiers
FT   CDS             93566..96691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47457"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1D218"
FT                   /protein_id="ACO47457.2"
FT                   /translation="MSRREDLVHQISRRLAALSTRRGGLAVALWGDPGVGKSWTAAEVL
FT                   RALPLRSAEVQASAPLSSVIVSLPRPARLPVWTEEALRRLERREVIAPDDMGDVLTSLL
FT                   SELAPFVLYVKDLHEASAEQLRLWQAVAGGVTRSRGVGLMATSRQPPPAPFEVQALGLL
FT                   DQEETAVLLNQTLGACLPAEAAEWIGQHAAGNPLFSIEYLRFLIRQGCLWNDGERWHWR
FT                   APRESRIPTSVEALISHLCHTPPLSAPAQAALEARAMLTAGMAPAVWAQVAGLEATQLQ
FT                   HACEELDHRGILREGQFVHRLYQDVELHHLTPARRRLISRRAVSALLETDVEAAATFVV
FT                   HAELPGNDALPLLRRAAGSAQSGGRHRQAAEYLSQAVQHAHGGERAQLALAAARLWRDH
FT                   EPRRVIALAEEVLEIEPRNLDAAFLLAGALVLQGEEERATRLIRSLQDSAELEPLWLFQ
FT                   LISLHADRNDYVGVMTLWQEHPGLHHLAPPSVLAQVVRALDFVGQPTEACTLAAQALEH
FT                   RGLTGPERTALLFARCRALYSAGNLEAAEADASEVVTLTEAGQRVHECARGLSTRATIR
FT                   DTLGRYPEALADAQTSLKLFASLGVARDYAQQQSRLACLLLEYGDYEQAETLLHEGHEV
FT                   MKRAGVSHFLALCEYNLAYLYLEQNPPFGGTLALKYAHAGLQHARQAGSPLIVAQTAAM
FT                   AARAEAIHGTPQHALELADEALDLTQQLGTSHDTAWAIWARGFALEACGRPAEALASFQ
FT                   AAADELAGRGLTLWAHRLGLEADRLAGDATAAGAKLAFFREHELRNWVNVTGRYFPGLA
FT                   GEHPVQAPAPASVRLSVLGSVQLHRGAEALRYKGQKGKELLACLLEARLAGQHEVRQLT
FT                   LQETLYPELQDGAAVSALQQLVYRLRQVLGPEVIQRTDGGYRLGAAESDAEDFLRTNDA
FT                   RLWRGPYLEDLGAGQDAAVEEALYHALERQAHELLASDAREAARVGRILLEHDPYDQRM
FT                   LALTLRALQSSGNRRGGQKLYQEIAARFAEVGEVLVPLQALLERPLSNSRST"
     MSRREDLVHQ ISRRLAALST RRGGLAVALW GDPGVGKSWT AAEVLRALPL RSAEVQASAP        60
     LSSVIVSLPR PARLPVWTEE ALRRLERREV IAPDDMGDVL TSLLSELAPF VLYVKDLHEA       120
     SAEQLRLWQA VAGGVTRSRG VGLMATSRQP PPAPFEVQAL GLLDQEETAV LLNQTLGACL       180
     PAEAAEWIGQ HAAGNPLFSI EYLRFLIRQG CLWNDGERWH WRAPRESRIP TSVEALISHL       240
     CHTPPLSAPA QAALEARAML TAGMAPAVWA QVAGLEATQL QHACEELDHR GILREGQFVH       300
     RLYQDVELHH LTPARRRLIS RRAVSALLET DVEAAATFVV HAELPGNDAL PLLRRAAGSA       360
     QSGGRHRQAA EYLSQAVQHA HGGERAQLAL AAARLWRDHE PRRVIALAEE VLEIEPRNLD       420
     AAFLLAGALV LQGEEERATR LIRSLQDSAE LEPLWLFQLI SLHADRNDYV GVMTLWQEHP       480
     GLHHLAPPSV LAQVVRALDF VGQPTEACTL AAQALEHRGL TGPERTALLF ARCRALYSAG       540
     NLEAAEADAS EVVTLTEAGQ RVHECARGLS TRATIRDTLG RYPEALADAQ TSLKLFASLG       600
     VARDYAQQQS RLACLLLEYG DYEQAETLLH EGHEVMKRAG VSHFLALCEY NLAYLYLEQN       660
     PPFGGTLALK YAHAGLQHAR QAGSPLIVAQ TAAMAARAEA IHGTPQHALE LADEALDLTQ       720
     QLGTSHDTAW AIWARGFALE ACGRPAEALA SFQAAADELA GRGLTLWAHR LGLEADRLAG       780
     DATAAGAKLA FFREHELRNW VNVTGRYFPG LAGEHPVQAP APASVRLSVL GSVQLHRGAE       840
     ALRYKGQKGK ELLACLLEAR LAGQHEVRQL TLQETLYPEL QDGAAVSALQ QLVYRLRQVL       900
     GPEVIQRTDG GYRLGAAESD AEDFLRTNDA RLWRGPYLED LGAGQDAAVE EALYHALERQ       960
     AHELLASDAR EAARVGRILL EHDPYDQRML ALTLRALQSS GNRRGGQKLY QEIAARFAEV      1020
     GEVLVPLQAL LERPLSNSRS T                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page