(data stored in ACNUC7421 zone)

EMBL: CP001115.PE68

CP001115.PE68        Location/Qualifiers
FT   CDS             98814..99323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00562"
FT                   /product="hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00562"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26547"
FT                   /db_xref="UniProtKB/TrEMBL:X5HN67"
FT                   /protein_id="AHX26547.1"
FT                   /translation="MMRTMLSLVPLLVVLAACNPQTSTIPNPQDPYAGLPAPLPSARTE
FT                   GIFAAQTNAAVRVGGVTLQRGAVATYVDLQETDGRVQGFALFRGLDKREQRVELSGTSQ
FT                   DGKVTVPLSVNVCGENIDLTLYGTINPATTVNFAGGSRTVKCYGVNVTATVDPFKVDRV
FT                   PTGGAQ"
     MMRTMLSLVP LLVVLAACNP QTSTIPNPQD PYAGLPAPLP SARTEGIFAA QTNAAVRVGG        60
     VTLQRGAVAT YVDLQETDGR VQGFALFRGL DKREQRVELS GTSQDGKVTV PLSVNVCGEN       120
     IDLTLYGTIN PATTVNFAGG SRTVKCYGVN VTATVDPFKV DRVPTGGAQ                   169
//

If you have problems or comments...

PBIL Back to PBIL home page