(data stored in ACNUC7421 zone)

EMBL: CP001115.PE69

CP001115.PE69        Location/Qualifiers
FT   CDS             99320..101044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00561"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00561"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47459"
FT                   /db_xref="UniProtKB/TrEMBL:C1D220"
FT                   /protein_id="ACO47459.1"
FT                   /translation="MNRRLKLAALLLSPLIGACSMPNIESAGISVAPGSLQLSAPEVNV
FT                   PLGGSGKVSVKVIKNCISPEEQATADIILAKVTPDGCHYVDENGEQRDHKENVWVGTQF
FT                   SSTPEPSIYDSNPKPEIWYTGKIPDGLSIQWANQPAEEQRGEVILAGKQGDISSTELTV
FT                   RTTSTVKPGSYVLHVTDNSSGRHNSAHNVKLTVNVTAPVPKSITGISASAQPTTITAGQ
FT                   TALMSASLTGTGDFDRTVRWSVMSGGGSLSASTGASVTYTSPSQATTAIIRAASAANPS
FT                   VYKDLTVTVKPPPPTITGVSVTATPTTIPSGGSSTLRATVSGTNNFNPAVTWSIVSGGG
FT                   TLSSTSGDTVTLTAPAGPANITVRASSVADMSKNDTVTVEVAAPDPQPGTAQLEGTITN
FT                   WNASSTGGQVSIETSNADHTALTVLSSAPVNQNGTFTLTLPVPSTLDPYTIDFGQSCTK
FT                   NVQPADLRVAGGSLYVTRDNVKRYLDSDASVRLSFLIYVDRAGSVDAQCTSTYTKPDGT
FT                   VMTERVEYKYTFAAAGWYPVYLTVSQTNATTTVYTHTSGPLSGAPSSYIESDPVATP"
     MNRRLKLAAL LLSPLIGACS MPNIESAGIS VAPGSLQLSA PEVNVPLGGS GKVSVKVIKN        60
     CISPEEQATA DIILAKVTPD GCHYVDENGE QRDHKENVWV GTQFSSTPEP SIYDSNPKPE       120
     IWYTGKIPDG LSIQWANQPA EEQRGEVILA GKQGDISSTE LTVRTTSTVK PGSYVLHVTD       180
     NSSGRHNSAH NVKLTVNVTA PVPKSITGIS ASAQPTTITA GQTALMSASL TGTGDFDRTV       240
     RWSVMSGGGS LSASTGASVT YTSPSQATTA IIRAASAANP SVYKDLTVTV KPPPPTITGV       300
     SVTATPTTIP SGGSSTLRAT VSGTNNFNPA VTWSIVSGGG TLSSTSGDTV TLTAPAGPAN       360
     ITVRASSVAD MSKNDTVTVE VAAPDPQPGT AQLEGTITNW NASSTGGQVS IETSNADHTA       420
     LTVLSSAPVN QNGTFTLTLP VPSTLDPYTI DFGQSCTKNV QPADLRVAGG SLYVTRDNVK       480
     RYLDSDASVR LSFLIYVDRA GSVDAQCTST YTKPDGTVMT ERVEYKYTFA AAGWYPVYLT       540
     VSQTNATTTV YTHTSGPLSG APSSYIESDP VATP                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page