(data stored in ACNUC7421 zone)

EMBL: CP001115.PE70

CP001115.PE70        Location/Qualifiers
FT   CDS             101377..102051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00580"
FT                   /product="Conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47461"
FT                   /db_xref="GOA:C1D222"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:C1D222"
FT                   /protein_id="ACO47461.1"
FT                   /translation="MSQQSPDHHSKRDLFSDLIGRTRFVVLIAVIAVLLVSFSLFLQGT
FT                   FLALHTIYETWHDMLTKGISSQSGTLAVEFLEVVGTMLKAVVFYLIGVGLYSLFIKPLN
FT                   LTSALGVESLSDLEQKVVSVIIVILGVTFLEHFIRWQNPLETLYFAGSLALAGGALVFF
FT                   QTVHRGKGSDLQQPEAKLRARRELFEHDTEQLVISERDVKRAEHATQAKIEGKVEAEAG
FT                   SE"
     MSQQSPDHHS KRDLFSDLIG RTRFVVLIAV IAVLLVSFSL FLQGTFLALH TIYETWHDML        60
     TKGISSQSGT LAVEFLEVVG TMLKAVVFYL IGVGLYSLFI KPLNLTSALG VESLSDLEQK       120
     VVSVIIVILG VTFLEHFIRW QNPLETLYFA GSLALAGGAL VFFQTVHRGK GSDLQQPEAK       180
     LRARRELFEH DTEQLVISER DVKRAEHATQ AKIEGKVEAE AGSE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page