(data stored in ACNUC7421 zone)

EMBL: CP001115.PE73

CP001115.PE73        Location/Qualifiers
FT   CDS             104941..105333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00610"
FT                   /product="putative ricin-type beta-trefoil lectin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47464"
FT                   /db_xref="GOA:C1D225"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C1D225"
FT                   /protein_id="ACO47464.1"
FT                   /translation="MCMDVQNGVATSTAQIQQWGCNGLPAQNFTLEQTAEGFYRLRSVL
FT                   GAQDMCLDNANGNSTPGTDVRLWSCNNAFAQNWHLEDMGHGYHRLIGQQTKLALDNPNG
FT                   STTAGTEIRTWSINGAAAQNWRLERR"
     MCMDVQNGVA TSTAQIQQWG CNGLPAQNFT LEQTAEGFYR LRSVLGAQDM CLDNANGNST        60
     PGTDVRLWSC NNAFAQNWHL EDMGHGYHRL IGQQTKLALD NPNGSTTAGT EIRTWSINGA       120
     AAQNWRLERR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page