(data stored in ACNUC7421 zone)

EMBL: CP001115.PE75

CP001115.PE75        Location/Qualifiers
FT   CDS             complement(106341..107174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00630"
FT                   /product="putative LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47466"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C1D227"
FT                   /protein_id="ACO47466.1"
FT                   /translation="MQASLLAVFAHPDDEALRCGGTLARYAAQGAAVTLICLTRGEAGK
FT                   NTDPELLVTDLAAQREQELRDSCAQLGVAPPIFLGYHDSCRGERLRRDDPLATINADPL
FT                   EIEARILEVIALVRPQVMLTFDPHGIYGHPDHLVAHRAATAAFTSAGIHGHAVHRLFYV
FT                   VQTGEEMRRLQSGQALGVLSGLAPQTYAVCEATVAARIDVRAHAGQKRAALRSHRTQTG
FT                   PLSTLGNLSDAQIGPLLEQETFSLGGLRGPLSRYPVEDLFEGLDVTFHQEQLCRT"
     MQASLLAVFA HPDDEALRCG GTLARYAAQG AAVTLICLTR GEAGKNTDPE LLVTDLAAQR        60
     EQELRDSCAQ LGVAPPIFLG YHDSCRGERL RRDDPLATIN ADPLEIEARI LEVIALVRPQ       120
     VMLTFDPHGI YGHPDHLVAH RAATAAFTSA GIHGHAVHRL FYVVQTGEEM RRLQSGQALG       180
     VLSGLAPQTY AVCEATVAAR IDVRAHAGQK RAALRSHRTQ TGPLSTLGNL SDAQIGPLLE       240
     QETFSLGGLR GPLSRYPVED LFEGLDVTFH QEQLCRT                                277
//

If you have problems or comments...

PBIL Back to PBIL home page