(data stored in ACNUC7421 zone)

EMBL: CP001115.PE8

CP001115.PE8         Location/Qualifiers
FT   CDS             7518..8825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00071"
FT                   /product="putative plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00071"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47397"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V8"
FT                   /protein_id="ACO47397.2"
FT                   /translation="MDKPSDLRIFEMDLTRSGIISVQRDMPTELTSWVSDYSISGNHYR
FT                   VEATARYGRPHGTDNDVMVALQSLFLRNGCPEHNRVSLTANQLLLQSYGRNTSKDYQNL
FT                   RASLMRLAGTNWTLYQNATDPKTRRTKGITTTNFMFTLEMEDHSASDHDFSHRDLDDSS
FT                   HIIVKFADTFAQSIRLGFFQMLDVHLMQRLGHTNARSLYRVIQGHRIQPDGSLAPSLDL
FT                   RLADWMSACGLETDRLDNARRILDAAHRRLLDEDFLQDVELTGRGRNATLHYAFQGVPE
FT                   PSQVEQLMAHRVTRPVAETLAADYPERVTPAISVIEERLKGGWRPRSVSAALVDAIRNP
FT                   EKWGYTPPPSRHGPKAASVPQPALHSPQEAEPLTTPRETARTLLRLRLGRDCSLFAQHE
FT                   IDQLSDAGMQALIEALHRPKEEGLPLVSSILNHVTL"
     MDKPSDLRIF EMDLTRSGII SVQRDMPTEL TSWVSDYSIS GNHYRVEATA RYGRPHGTDN        60
     DVMVALQSLF LRNGCPEHNR VSLTANQLLL QSYGRNTSKD YQNLRASLMR LAGTNWTLYQ       120
     NATDPKTRRT KGITTTNFMF TLEMEDHSAS DHDFSHRDLD DSSHIIVKFA DTFAQSIRLG       180
     FFQMLDVHLM QRLGHTNARS LYRVIQGHRI QPDGSLAPSL DLRLADWMSA CGLETDRLDN       240
     ARRILDAAHR RLLDEDFLQD VELTGRGRNA TLHYAFQGVP EPSQVEQLMA HRVTRPVAET       300
     LAADYPERVT PAISVIEERL KGGWRPRSVS AALVDAIRNP EKWGYTPPPS RHGPKAASVP       360
     QPALHSPQEA EPLTTPRETA RTLLRLRLGR DCSLFAQHEI DQLSDAGMQA LIEALHRPKE       420
     EGLPLVSSIL NHVTL                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page