(data stored in ACNUC7421 zone)

EMBL: CP001115.PE82

CP001115.PE82        Location/Qualifiers
FT   CDS             complement(113893..114267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00682"
FT                   /product="Hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00682"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47472"
FT                   /db_xref="GOA:C1D233"
FT                   /db_xref="UniProtKB/TrEMBL:C1D233"
FT                   /protein_id="ACO47472.1"
FT                   /translation="MDMQFMGTVLVTASVAAFSWLTLRVWQIRSPKTARFLPLRFLHAF
FT                   TTVYFPLVAHSYLETLHRVQTEYANDAPNIAMAWGDHHNAVIFSRGAALVIAVYTVIIV
FT                   VTVRTHGQPDGAQLTFHQNH"
     MDMQFMGTVL VTASVAAFSW LTLRVWQIRS PKTARFLPLR FLHAFTTVYF PLVAHSYLET        60
     LHRVQTEYAN DAPNIAMAWG DHHNAVIFSR GAALVIAVYT VIIVVTVRTH GQPDGAQLTF       120
     HQNH                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page