(data stored in ACNUC7421 zone)

EMBL: CP001115.PE83

CP001115.PE83        Location/Qualifiers
FT   CDS             114569..114949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00690"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47473"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:C1D234"
FT                   /protein_id="ACO47473.1"
FT                   /translation="MTLLAKNPQGPIVDSSISDLDGVWAHDPERGSCPYPPGTALNGLV
FT                   IFALVLDELLDLNDHVQMPELRFYPVVPLTVEEMDFKLTLGLDALLERLDKGEVRELVD
FT                   TRAWLHLHTSLGGGGSNVRSSN"
     MTLLAKNPQG PIVDSSISDL DGVWAHDPER GSCPYPPGTA LNGLVIFALV LDELLDLNDH        60
     VQMPELRFYP VVPLTVEEMD FKLTLGLDAL LERLDKGEVR ELVDTRAWLH LHTSLGGGGS       120
     NVRSSN                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page