(data stored in ACNUC7421 zone)

EMBL: CP001115.PE84

CP001115.PE84        Location/Qualifiers
FT   CDS             complement(115552..115959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00695"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26548"
FT                   /db_xref="GOA:X5H5T9"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5T9"
FT                   /protein_id="AHX26548.1"
FT                   /translation="MSRQERFLSVVVALNGLVLLLTGLTLAVVPEWFYTHLAPFAPFNR
FT                   HFAGDAGIFSAALGGILLVAARQVRALGPVVVIGAAASLWHALNHMYDHWQISGSLSHL
FT                   LDTNHAWKDLSLVLLAGLTLWTLTVSRSRKL"
     MSRQERFLSV VVALNGLVLL LTGLTLAVVP EWFYTHLAPF APFNRHFAGD AGIFSAALGG        60
     ILLVAARQVR ALGPVVVIGA AASLWHALNH MYDHWQISGS LSHLLDTNHA WKDLSLVLLA       120
     GLTLWTLTVS RSRKL                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page