(data stored in ACNUC7421 zone)

EMBL: CP001115.PE85

CP001115.PE85        Location/Qualifiers
FT   CDS             complement(115956..116462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47474"
FT                   /db_xref="GOA:C1D235"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1D235"
FT                   /protein_id="ACO47474.1"
FT                   /translation="MASRALTWRFGKPFPTVALLSHHPAYPVPYLFMAGIYGNGSTKLN
FT                   PTTKALVSHLVAQLNGCAFCIDLGQRVARDKGLDTSKLQWVLAFRERPEYSPAERAALE
FT                   YAWEATQVTAKVSDETYATLSSFYSEREIIELTVAVATENFFNRLTGPLNIESQGFCAL
FT                   PDRQP"
     MASRALTWRF GKPFPTVALL SHHPAYPVPY LFMAGIYGNG STKLNPTTKA LVSHLVAQLN        60
     GCAFCIDLGQ RVARDKGLDT SKLQWVLAFR ERPEYSPAER AALEYAWEAT QVTAKVSDET       120
     YATLSSFYSE REIIELTVAV ATENFFNRLT GPLNIESQGF CALPDRQP                    168
//

If you have problems or comments...

PBIL Back to PBIL home page