(data stored in ACNUC7421 zone)

EMBL: CP001115.PE9

CP001115.PE9         Location/Qualifiers
FT   CDS             9165..9686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47398"
FT                   /db_xref="UniProtKB/TrEMBL:C1D1V9"
FT                   /protein_id="ACO47398.2"
FT                   /translation="MNTRWVIVGLSLMIAGGMRTVAIQIPGTKVDYFAAQDSVTTDNRG
FT                   MVRIFEVNDTTGETFVRFACEGRVMQAYFHGKNPLLTPRAREIELYPLVVYQVDSQQLK
FT                   TLKASGTLDEGGTPALDSLAFENDELVVEAFRNAGERVILRIPRLGMSELTFTFAVKGF
FT                   REGLSRIKPC"
     MNTRWVIVGL SLMIAGGMRT VAIQIPGTKV DYFAAQDSVT TDNRGMVRIF EVNDTTGETF        60
     VRFACEGRVM QAYFHGKNPL LTPRAREIEL YPLVVYQVDS QQLKTLKASG TLDEGGTPAL       120
     DSLAFENDEL VVEAFRNAGE RVILRIPRLG MSELTFTFAV KGFREGLSRI KPC              173
//

If you have problems or comments...

PBIL Back to PBIL home page