(data stored in ACNUC7421 zone)

EMBL: CP001115.PE97

CP001115.PE97        Location/Qualifiers
FT   CDS             137021..138010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47488"
FT                   /db_xref="UniProtKB/TrEMBL:C1D249"
FT                   /protein_id="ACO47488.2"
FT                   /translation="MILLAHLVMGSAFAQSTQAPPPTSRPPAVAPVAPVSPAPSGSNTG
FT                   NTTTRTATDPCQQFSLSASGNTRLTPEQEAQRAASERRCIEANSGNPDVLLDIPNLSVE
FT                   EITLEVENLRANVALDARLANLLLLTAGADVSIDKVKLTIKGVRAQALLKVNLDNVARI
FT                   IDRTLTTIDRNPQILERLLTSVDNAVGTVGNVANTAVQPGGVVDRAVGTVGQTLNNVTQ
FT                   PGGVLTQTVNSLGQTVQRTIDATGNIVERTVTSAGQVLGQTLTVGNISSLKVLRETNNA
FT                   AGQIVRQLQDTTGAIFEVTLDKDNRVIAYRLLQAAPGTTPATPAPGGR"
     MILLAHLVMG SAFAQSTQAP PPTSRPPAVA PVAPVSPAPS GSNTGNTTTR TATDPCQQFS        60
     LSASGNTRLT PEQEAQRAAS ERRCIEANSG NPDVLLDIPN LSVEEITLEV ENLRANVALD       120
     ARLANLLLLT AGADVSIDKV KLTIKGVRAQ ALLKVNLDNV ARIIDRTLTT IDRNPQILER       180
     LLTSVDNAVG TVGNVANTAV QPGGVVDRAV GTVGQTLNNV TQPGGVLTQT VNSLGQTVQR       240
     TIDATGNIVE RTVTSAGQVL GQTLTVGNIS SLKVLRETNN AAGQIVRQLQ DTTGAIFEVT       300
     LDKDNRVIAY RLLQAAPGTT PATPAPGGR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page