(data stored in ACNUC7421 zone)

EMBL: CP001115.PE98

CP001115.PE98        Location/Qualifiers
FT   CDS             complement(138162..138668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00833"
FT                   /product="conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00833"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26549"
FT                   /db_xref="UniProtKB/TrEMBL:X5GY69"
FT                   /protein_id="AHX26549.1"
FT                   /translation="MKRAIVLTTILTTCVIAAAQPPASLPPVTTGPAAAVSYTFEILDA
FT                   SRQPVATFDATGKLQVSGTLSTGTFLRLSRPGASRLFQLAQPVTPGTTLGEVVLVYGNS
FT                   TVTLGALLNGTSGTAESSRPSVTPQQLNALLGLSTSVGSVSVGMSTSLSVNGLPLTLPL
FT                   ILPLF"
     MKRAIVLTTI LTTCVIAAAQ PPASLPPVTT GPAAAVSYTF EILDASRQPV ATFDATGKLQ        60
     VSGTLSTGTF LRLSRPGASR LFQLAQPVTP GTTLGEVVLV YGNSTVTLGA LLNGTSGTAE       120
     SSRPSVTPQQ LNALLGLSTS VGSVSVGMST SLSVNGLPLT LPLILPLF                    168
//

If you have problems or comments...

PBIL Back to PBIL home page