(data stored in ACNUC7421 zone)

EMBL: CP001115.PE99

CP001115.PE99        Location/Qualifiers
FT   CDS             139021..139281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00835"
FT                   /db_xref="EnsemblGenomes-Tr:AHX26550"
FT                   /db_xref="UniProtKB/TrEMBL:X5H5N3"
FT                   /protein_id="AHX26550.1"
FT                   /translation="MDDFYRGYRVRVMHHTQDEYVATAQYCDSNEAAEGGFTHAFLFPA
FT                   EVYPDKATVMMYLRAYVDGMAPKSVPQRELKDPQPMRQPGS"
     MDDFYRGYRV RVMHHTQDEY VATAQYCDSN EAAEGGFTHA FLFPAEVYPD KATVMMYLRA        60
     YVDGMAPKSV PQRELKDPQP MRQPGS                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page