(data stored in SCRATCH zone)

EMBL: CP001163.CCDA2

CP001163.CCDA2       Location/Qualifiers
FT   CDS             12783..13001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA2"
FT                   /locus_tag="ECH74115_B0034"
FT                   /product="post-segregation antitoxin CcdA"
FT                   /note="identified by match to protein family HMM PF07362"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34523"
FT                   /protein_id="ACI34523.1"
FT                   /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWK
FT                   AENQEGMAEVARFIEMNGSFADENRDW"
     MKQRITVTVD SDSYQLLKAY DVNISGLVST TMQNEARRLR AERWKAENQE GMAEVARFIE        60
     MNGSFADENR DW                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page