(data stored in SCRATCH zone)

EMBL: CP001163.FINO

CP001163.FINO        Location/Qualifiers
FT   CDS             52994..53629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="finO"
FT                   /locus_tag="ECH74115_B0082"
FT                   /product="fertility inhibition protein"
FT                   /note="identified by match to protein family HMM PF05286"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34452"
FT                   /protein_id="ACI34452.1"
FT                   /translation="MKLTSCYDEPFQRPAGHIFTKVRVSMAEQKRPVLTLKRKTEGETP
FT                   VRSRKTIINVTTPPKWKVKKQKLAEKAAREAELAAKKAQARQALSIYLNLPTQDEAVNT
FT                   LKPWWPGLFDGDTPRLLACGIRDVLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMK
FT                   AGACRYDTEGYVTEHISQEEEAYAAARLDKIRRQNRIKAELQAVLDEK"
     MKLTSCYDEP FQRPAGHIFT KVRVSMAEQK RPVLTLKRKT EGETPVRSRK TIINVTTPPK        60
     WKVKKQKLAE KAAREAELAA KKAQARQALS IYLNLPTQDE AVNTLKPWWP GLFDGDTPRL       120
     LACGIRDVLL EDVAQRNIPL SHKKLRRALK AITRSESYLC AMKAGACRYD TEGYVTEHIS       180
     QEEEAYAAAR LDKIRRQNRI KAELQAVLDE K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page