(data stored in SCRATCH zone)

EMBL: CP001163.GSPC

CP001163.GSPC        Location/Qualifiers
FT   CDS             81334..82209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="ECH74115_B0002"
FT                   /product="general secretion pathway protein C"
FT                   /note="identified by match to protein family HMM TIGR01713"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34434"
FT                   /protein_id="ACI34434.1"
FT                   /translation="MLFFLSFRGDRGLFIKDIVLKMLTPNRLLCVILLIAGYQLVSVIH
FT                   HFWLTQAASVPGLSRVSAPETAVTGDQTEERFVFTLFGRASPLSSEGRAQETMPSLSDD
FT                   LLSGEDLDVRGILYSSVAEHSVAIFAHNNRQFSLSVGEKVPSYDATISAIFSDHIVINY
FT                   QGKTVSLPLRYDNTEKKNAYDNNNLTVGDVITQDNFRVESVFDIMSFSAVTVNNTLSGY
FT                   RLIPGKHSSLFYNAGLHDNDLAVSVNGSELRDTRQAQQIMKQLPELKEIKITVERDGQL
FT                   YDAFIAVGEN"
     MLFFLSFRGD RGLFIKDIVL KMLTPNRLLC VILLIAGYQL VSVIHHFWLT QAASVPGLSR        60
     VSAPETAVTG DQTEERFVFT LFGRASPLSS EGRAQETMPS LSDDLLSGED LDVRGILYSS       120
     VAEHSVAIFA HNNRQFSLSV GEKVPSYDAT ISAIFSDHIV INYQGKTVSL PLRYDNTEKK       180
     NAYDNNNLTV GDVITQDNFR VESVFDIMSF SAVTVNNTLS GYRLIPGKHS SLFYNAGLHD       240
     NDLAVSVNGS ELRDTRQAQQ IMKQLPELKE IKITVERDGQ LYDAFIAVGE N                291
//

If you have problems or comments...

PBIL Back to PBIL home page