(data stored in SCRATCH zone)

EMBL: CP001163.GSPD

CP001163.GSPD        Location/Qualifiers
FT   CDS             82210..84177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="ECH74115_B0003"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by match to protein family HMM PF00263;
FT                   match to protein family HMM PF03958; match to protein
FT                   family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34510"
FT                   /protein_id="ACI34510.1"
FT                   /translation="MFRKWLNGRLPVLVFTTVILGAIPGWGAEFSANFKDTDIQEFINT
FT                   VSKNLHKTVIINPDVQGTITVRSYDMLNEEQYYQFFLSVLDVYGFAVVDMHNGILKVVR
FT                   SKDAKTSAVPVASDVSPGTGDEVVTRVVPVSNVAARDLAPLLRQLNDNAGAGSVVHYEP
FT                   SNVLLMTGRAAVMKRLMEIVERVDKVGNRSVATVPLTYASATDVARLVTELTKETDKTA
FT                   IPAWMTAKLVADERTNSVLVSGEPISQQRIISIIKQLDRQEDVQGNTKVIYLKYAKAKD
FT                   LVEVLTGISSSIENDSKKSPSTEALRKGVTIKSHEQTNALILTGAPDVIRDLENVISQL
FT                   DIRRPQVLVEAIIAEIQDADGLNLGIQWVNKHAGVAQFTSTGLPITTMVQTRQNEILDS
FT                   DQSNALSMFNGIAAGFYQGNWAMLLTALSTSSKNDILATPSIVTLDNMEATFNVGQEVP
FT                   VLSGSQTTSGDNIFNTVERKTVGIKLRVKPQINEGDSVLLEIEQEVSGVADTAVATTTD
FT                   LGATFNTRTVTNAMLVGNGETVVVGGLLDKSIRGSESKVPLLGDIPVLGHLFRAKSEQT
FT                   AKRNLMLFIRPTIIRERDGFRHASAEKYQSFNQEQVQSRGKETTALTLNEEQLRLSPDQ
FT                   DDTAFRKVKAAIAAFYAQEM"
     MFRKWLNGRL PVLVFTTVIL GAIPGWGAEF SANFKDTDIQ EFINTVSKNL HKTVIINPDV        60
     QGTITVRSYD MLNEEQYYQF FLSVLDVYGF AVVDMHNGIL KVVRSKDAKT SAVPVASDVS       120
     PGTGDEVVTR VVPVSNVAAR DLAPLLRQLN DNAGAGSVVH YEPSNVLLMT GRAAVMKRLM       180
     EIVERVDKVG NRSVATVPLT YASATDVARL VTELTKETDK TAIPAWMTAK LVADERTNSV       240
     LVSGEPISQQ RIISIIKQLD RQEDVQGNTK VIYLKYAKAK DLVEVLTGIS SSIENDSKKS       300
     PSTEALRKGV TIKSHEQTNA LILTGAPDVI RDLENVISQL DIRRPQVLVE AIIAEIQDAD       360
     GLNLGIQWVN KHAGVAQFTS TGLPITTMVQ TRQNEILDSD QSNALSMFNG IAAGFYQGNW       420
     AMLLTALSTS SKNDILATPS IVTLDNMEAT FNVGQEVPVL SGSQTTSGDN IFNTVERKTV       480
     GIKLRVKPQI NEGDSVLLEI EQEVSGVADT AVATTTDLGA TFNTRTVTNA MLVGNGETVV       540
     VGGLLDKSIR GSESKVPLLG DIPVLGHLFR AKSEQTAKRN LMLFIRPTII RERDGFRHAS       600
     AEKYQSFNQE QVQSRGKETT ALTLNEEQLR LSPDQDDTAF RKVKAAIAAF YAQEM            655
//

If you have problems or comments...

PBIL Back to PBIL home page