(data stored in SCRATCH zone)

EMBL: CP001163.GSPE

CP001163.GSPE        Location/Qualifiers
FT   CDS             84177..85682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="ECH74115_B0004"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34497"
FT                   /protein_id="ACI34497.1"
FT                   /translation="MSRVVQNVSESRPLLPFSFSRTQRILLLREQEGNRVFCMEDTPAS
FT                   ALLEVRRVAEGPLNVTTVSAEAFEKQLVSSYQRDSDEARQMMAEIGNEMDFYTVAGELP
FT                   DREDLLDANDDAPIIRLINAMLTEAIKEKASDIHIETYERHLQVRFRIDGVLREILRLH
FT                   RNLASLLISRIKVMARLDIAEKRVPQDGRMVLRIGGRAVDVRVSTLPSNHGERIVLRLL
FT                   DKNSVSLDLAALGMSQQNQRHIDALIRRPHGIILVTGPTGSGKSTTLYAALSLLNPRDR
FT                   NIMTVEDPVEYELDGISQTQVNPKVDMTFARSLRAILRQDPDVVLVGEIRDGETAQIAV
FT                   QASLTGHLVLSTLHTNSAAGALSRLQDMGIPPFLLSTSLLAVLAQRLVRTLCPRCRQPC
FT                   QVSTELAMDMDIPPETTIWQPAGCQHCSFTGYHGRTGIHELLLIDDRIRTAIYQGEGEL
FT                   GITRLAGSRYLTLRGDGRQKVLAGETSWEEVVRVTESRLQEEE"
     MSRVVQNVSE SRPLLPFSFS RTQRILLLRE QEGNRVFCME DTPASALLEV RRVAEGPLNV        60
     TTVSAEAFEK QLVSSYQRDS DEARQMMAEI GNEMDFYTVA GELPDREDLL DANDDAPIIR       120
     LINAMLTEAI KEKASDIHIE TYERHLQVRF RIDGVLREIL RLHRNLASLL ISRIKVMARL       180
     DIAEKRVPQD GRMVLRIGGR AVDVRVSTLP SNHGERIVLR LLDKNSVSLD LAALGMSQQN       240
     QRHIDALIRR PHGIILVTGP TGSGKSTTLY AALSLLNPRD RNIMTVEDPV EYELDGISQT       300
     QVNPKVDMTF ARSLRAILRQ DPDVVLVGEI RDGETAQIAV QASLTGHLVL STLHTNSAAG       360
     ALSRLQDMGI PPFLLSTSLL AVLAQRLVRT LCPRCRQPCQ VSTELAMDMD IPPETTIWQP       420
     AGCQHCSFTG YHGRTGIHEL LLIDDRIRTA IYQGEGELGI TRLAGSRYLT LRGDGRQKVL       480
     AGETSWEEVV RVTESRLQEE E                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page