(data stored in SCRATCH zone)

EMBL: CP001163.GSPF

CP001163.GSPF        Location/Qualifiers
FT   CDS             85684..86907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="ECH74115_B0005"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34502"
FT                   /protein_id="ACI34502.1"
FT                   /translation="MALFHYQASDIHGRKRSGILEADSARHARQLLREQALIPVRLDEK
FT                   QVHHKHSLRSILRFRPRGGSSAELALLTRQLATLVAASLPLEEALDALLRQSEKPRQRN
FT                   LIAAVRTKVLEGHSLAAAMGMFPGTFERLYCAMVAAGETSGRLDVVLSRLADYTEQRQI
FT                   MRNRLLQALLYPCVLTLVAVGVIAILLTAVVPKVVEQFIHMKQTLPLSTRVLMGAAEVS
FT                   QTWGPWLLLAAALGGIAGRMILHQPSQRLAFHHLLLRLPVVGRISRGLNTARYARTLSI
FT                   LNASAVPLLQAMHISGDVLSNDWARHQLATAAELVREGVSLHQALEQTSLFPPMMRHMI
FT                   ASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAILQPLL
FT                   QLNNMMNM"
     MALFHYQASD IHGRKRSGIL EADSARHARQ LLREQALIPV RLDEKQVHHK HSLRSILRFR        60
     PRGGSSAELA LLTRQLATLV AASLPLEEAL DALLRQSEKP RQRNLIAAVR TKVLEGHSLA       120
     AAMGMFPGTF ERLYCAMVAA GETSGRLDVV LSRLADYTEQ RQIMRNRLLQ ALLYPCVLTL       180
     VAVGVIAILL TAVVPKVVEQ FIHMKQTLPL STRVLMGAAE VSQTWGPWLL LAAALGGIAG       240
     RMILHQPSQR LAFHHLLLRL PVVGRISRGL NTARYARTLS ILNASAVPLL QAMHISGDVL       300
     SNDWARHQLA TAAELVREGV SLHQALEQTS LFPPMMRHMI ASGENSGELD SMLERAADNQ       360
     DREFSTQMQL ALGLFEPLLV VGMAGVVLFI VLAILQPLLQ LNNMMNM                     407
//

If you have problems or comments...

PBIL Back to PBIL home page