(data stored in SCRATCH zone)

EMBL: CP001163.GSPG

CP001163.GSPG        Location/Qualifiers
FT   CDS             86938..87372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="ECH74115_B0006"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM PF08334; match to protein
FT                   family HMM TIGR01710; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34464"
FT                   /protein_id="ACI34464.1"
FT                   /translation="MRKQHQRGFTLLEIMVVIVILGVLASLVVPNLMGNKDKADRQKVM
FT                   SDLVALESTLDMYRLDNNRYPTTEQGLRALVSKPTVQPEPRNYRQDGYIRRLPQDPWGG
FT                   DYQLLNPGQYSDIDIFSPGPDGVPNTEDDIGNWTLGNAQP"
     MRKQHQRGFT LLEIMVVIVI LGVLASLVVP NLMGNKDKAD RQKVMSDLVA LESTLDMYRL        60
     DNNRYPTTEQ GLRALVSKPT VQPEPRNYRQ DGYIRRLPQD PWGGDYQLLN PGQYSDIDIF       120
     SPGPDGVPNT EDDIGNWTLG NAQP                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page