(data stored in SCRATCH zone)

EMBL: CP001163.GSPH

CP001163.GSPH        Location/Qualifiers
FT   CDS             87369..87923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="ECH74115_B0007"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34475"
FT                   /protein_id="ACI34475.1"
FT                   /translation="MSQRGFTILEMMLILLLMGITAGLVLMSFPDSAQNHLQQQRERLQ
FT                   AQLDYALDRSQQDGLLMGIQVRFDGWKFKVLQRGTAESPPTLAEGGDIWQGYVWQTWQP
FT                   RRAAMGGKLPDDVRLELQYLRGLQWMSEHDDGAEPDILLLPGGEVTPFRLLFRQVGEEA
FT                   VVGLQVDENGLMTLFEGEVSL"
     MSQRGFTILE MMLILLLMGI TAGLVLMSFP DSAQNHLQQQ RERLQAQLDY ALDRSQQDGL        60
     LMGIQVRFDG WKFKVLQRGT AESPPTLAEG GDIWQGYVWQ TWQPRRAAMG GKLPDDVRLE       120
     LQYLRGLQWM SEHDDGAEPD ILLLPGGEVT PFRLLFRQVG EEAVVGLQVD ENGLMTLFEG       180
     EVSL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page