(data stored in SCRATCH zone)

EMBL: CP001163.GSPI

CP001163.GSPI        Location/Qualifiers
FT   CDS             87920..88285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="ECH74115_B0008"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501;
FT                   match to protein family HMM PF07963; match to protein
FT                   family HMM TIGR01707; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34488"
FT                   /protein_id="ACI34488.1"
FT                   /translation="MKGQEGMTLLEVIVALVVFALAGMALMQASTQQAAGIGRMEEKVL
FT                   AGWLADNQMVQLQLEKTWPENGWGEKTISFAGTEWYLRWGGPDSDVPQPRSLEVEVRRT
FT                   KEETSALVSLRSSVVRE"
     MKGQEGMTLL EVIVALVVFA LAGMALMQAS TQQAAGIGRM EEKVLAGWLA DNQMVQLQLE        60
     KTWPENGWGE KTISFAGTEW YLRWGGPDSD VPQPRSLEVE VRRTKEETSA LVSLRSSVVR       120
     E                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page