(data stored in SCRATCH zone)

EMBL: CP001163.GSPJ

CP001163.GSPJ        Location/Qualifiers
FT   CDS             88282..88881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="ECH74115_B0009"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01711; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34455"
FT                   /protein_id="ACI34455.1"
FT                   /translation="MSQQRVKGFTLLEMLLALAVFAALSISAFQVLQGGIRAHELSRDK
FT                   VQRLAELQRGISQMERDLTQMLPRHSRGNEGLLLAAPHLLKSDDWGISFTRNSWLNPAG
FT                   MLPRPELQWVGYRLRQQKLERLSYFHVDHPSGVSPDVRVMLDGVHAFRLRFFVNGDWQA
FT                   RWDSTGILPQAVEVTLVMDDFAELPRLFLVSKETAE"
     MSQQRVKGFT LLEMLLALAV FAALSISAFQ VLQGGIRAHE LSRDKVQRLA ELQRGISQME        60
     RDLTQMLPRH SRGNEGLLLA APHLLKSDDW GISFTRNSWL NPAGMLPRPE LQWVGYRLRQ       120
     QKLERLSYFH VDHPSGVSPD VRVMLDGVHA FRLRFFVNGD WQARWDSTGI LPQAVEVTLV       180
     MDDFAELPRL FLVSKETAE                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page