(data stored in SCRATCH zone)

EMBL: CP001163.GSPK

CP001163.GSPK        Location/Qualifiers
FT   CDS             88878..89855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="ECH74115_B0010"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34479"
FT                   /protein_id="ACI34479.1"
FT                   /translation="MKLREQGVALLVVLLILSLMVTIAAVIAERNGRTFLRTVAQLDQL
FT                   QAKWDGYTAETIAKQILQRSRQESPRKTHLAQNWAQSERQFETRGGDVRGQIVDAQACF
FT                   NLNAINYGVVDLTSIPYAARIFQQLLINLQVELLQARQVTAALRDWIDRDDKPVRGGAE
FT                   DEVYMGMEPPYLAANQPMQDVSELRLIRGIDARLYRKLLPYVCVLPTSDLSVNVNTLLD
FT                   SQAPLLAALFLTKPDSLPVTELLQRRPRTGWESVAAFLDAPPLKDIDTSAAMPVLAVSS
FT                   NYFLVRLHVRSGEHLFSQQTLMQWREERFRIIQRQYGLTMREVP"
     MKLREQGVAL LVVLLILSLM VTIAAVIAER NGRTFLRTVA QLDQLQAKWD GYTAETIAKQ        60
     ILQRSRQESP RKTHLAQNWA QSERQFETRG GDVRGQIVDA QACFNLNAIN YGVVDLTSIP       120
     YAARIFQQLL INLQVELLQA RQVTAALRDW IDRDDKPVRG GAEDEVYMGM EPPYLAANQP       180
     MQDVSELRLI RGIDARLYRK LLPYVCVLPT SDLSVNVNTL LDSQAPLLAA LFLTKPDSLP       240
     VTELLQRRPR TGWESVAAFL DAPPLKDIDT SAAMPVLAVS SNYFLVRLHV RSGEHLFSQQ       300
     TLMQWREERF RIIQRQYGLT MREVP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page