(data stored in SCRATCH zone)

EMBL: CP001163.GSPL

CP001163.GSPL        Location/Qualifiers
FT   CDS             89927..91066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="ECH74115_B0011"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34435"
FT                   /protein_id="ACI34435.1"
FT                   /translation="MWRLIAPEETGAGSVAVGETDPQLVGLLSRYPAWVLVPSGRIAFH
FT                   QVTLPHRTWRQRLQVLPFLLEEQLATDIEQLHFAILHQSGDRCDVAVVEKAVMHRWLAY
FT                   CGQLGVREVRLLPDVLMLPLATEGWSAVKLAGQWLFRRDRYAGMTVELSWLTHFLSLTA
FT                   PPVIESYSVPPVPCPGPKTTEWRNQPGRDLLQLVAEGDGYDGADLRQGEFARQGTWYAR
FT                   FRPWRYVAGALLACVFLAGSNAGLAHYRLWQQAQFWRYESVRVYQQLFPSEKAVKDPRR
FT                   QMLRHLQQSTGNNIPELGSVMRQLQQLLSETSTIRLQALAWDSSSQTLKIDLQAASFQA
FT                   LEHFQQIAGEKYLIQPGEIRQQPQGVESRLILRVNNERA"
     MWRLIAPEET GAGSVAVGET DPQLVGLLSR YPAWVLVPSG RIAFHQVTLP HRTWRQRLQV        60
     LPFLLEEQLA TDIEQLHFAI LHQSGDRCDV AVVEKAVMHR WLAYCGQLGV REVRLLPDVL       120
     MLPLATEGWS AVKLAGQWLF RRDRYAGMTV ELSWLTHFLS LTAPPVIESY SVPPVPCPGP       180
     KTTEWRNQPG RDLLQLVAEG DGYDGADLRQ GEFARQGTWY ARFRPWRYVA GALLACVFLA       240
     GSNAGLAHYR LWQQAQFWRY ESVRVYQQLF PSEKAVKDPR RQMLRHLQQS TGNNIPELGS       300
     VMRQLQQLLS ETSTIRLQAL AWDSSSQTLK IDLQAASFQA LEHFQQIAGE KYLIQPGEIR       360
     QQPQGVESRL ILRVNNERA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page