(data stored in SCRATCH zone)

EMBL: CP001163.HOK

CP001163.HOK         Location/Qualifiers
FT   CDS             34927..35085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hok"
FT                   /locus_tag="ECH74115_B0071"
FT                   /product="stable plasmid inheritance protein Hok"
FT                   /note="identified by match to protein family HMM PF01848"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34495"
FT                   /protein_id="ACI34495.1"
FT                   /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAF
FT                   MAYESGK"
     MKLPRSSLVW CVLIVCLTLL IFTYLTRKSL CEIRYRDGYR EVAAFMAYES GK                52
//

If you have problems or comments...

PBIL Back to PBIL home page