(data stored in SCRATCH zone)

EMBL: CP001163.KATG

CP001163.KATG        Location/Qualifiers
FT   CDS             60441..62651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="ECH74115_B0099"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="identified by match to protein family HMM PF00141;
FT                   match to protein family HMM TIGR00198"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34426"
FT                   /protein_id="ACI34426.1"
FT                   /translation="MIKKTLPVLILLALSGSFSTAVAADKKETQNFYYPETLDLTPLRL
FT                   HSPESNPWGADFDYATRFQQLDMEALKKDIKDLLTTSQDWWPADYGHYGPFFIRMAWHG
FT                   AGTYRTYDGRGGASGGQQRFEPLNSWPDNVNLDKARRLLWPVKKKYGSSISWGDLMVLT
FT                   GNVALESMGFKTLGFAGGREDDWESDLVYWGPDNKPLADNRDKNGKLQKPLAATQMGLI
FT                   YVNPEGPGGKPDPLASAKDIREAFSRMAMDDEETVALIAGGHTFGKAHGAASPEKCIGA
FT                   GPDGAPVEEQGLGWKNKCGTGNGKYTITSGLEGAWSTSPTQFTMQYLKNLYKYEWELHK
FT                   SPAGAYQWKPKKAANIVQDAHDPSVLHPLMMFTTDIALKVDPEYKKITTRFLNDPKAFE
FT                   QAFARAWFKLTHRDMGPAARYLGNEVPAESFIWQDPLPAADYTMIDGKDIKSLKEQVMD
FT                   LGIPASELIKTAWASASTFRVTDYRGGNNGARIRLQPEINWEVNEPEKLKKVLASLTSL
FT                   QREFNKKQSDGKKVSLADLIVLSGNAAIEDAARKAGVELEIPFTPGRTDASQEQTDVAS
FT                   FSVLEPTADGFRNYYSKSRSHISPVESLIDKASQLDLTVPEMTALLGGLRVMDINTNNS
FT                   SLGVFTDTPGVLDNKFFVNLLDMSTRWSKADKEDTYNGFDRKTGALKWKASSVDLIFSS
FT                   NPELRAVAEVYASDDARNKFIHDFVKSWNKVMNSDRFDLNNK"
     MIKKTLPVLI LLALSGSFST AVAADKKETQ NFYYPETLDL TPLRLHSPES NPWGADFDYA        60
     TRFQQLDMEA LKKDIKDLLT TSQDWWPADY GHYGPFFIRM AWHGAGTYRT YDGRGGASGG       120
     QQRFEPLNSW PDNVNLDKAR RLLWPVKKKY GSSISWGDLM VLTGNVALES MGFKTLGFAG       180
     GREDDWESDL VYWGPDNKPL ADNRDKNGKL QKPLAATQMG LIYVNPEGPG GKPDPLASAK       240
     DIREAFSRMA MDDEETVALI AGGHTFGKAH GAASPEKCIG AGPDGAPVEE QGLGWKNKCG       300
     TGNGKYTITS GLEGAWSTSP TQFTMQYLKN LYKYEWELHK SPAGAYQWKP KKAANIVQDA       360
     HDPSVLHPLM MFTTDIALKV DPEYKKITTR FLNDPKAFEQ AFARAWFKLT HRDMGPAARY       420
     LGNEVPAESF IWQDPLPAAD YTMIDGKDIK SLKEQVMDLG IPASELIKTA WASASTFRVT       480
     DYRGGNNGAR IRLQPEINWE VNEPEKLKKV LASLTSLQRE FNKKQSDGKK VSLADLIVLS       540
     GNAAIEDAAR KAGVELEIPF TPGRTDASQE QTDVASFSVL EPTADGFRNY YSKSRSHISP       600
     VESLIDKASQ LDLTVPEMTA LLGGLRVMDI NTNNSSLGVF TDTPGVLDNK FFVNLLDMST       660
     RWSKADKEDT YNGFDRKTGA LKWKASSVDL IFSSNPELRA VAEVYASDDA RNKFIHDFVK       720
     SWNKVMNSDR FDLNNK                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page