(data stored in SCRATCH zone)

EMBL: CP001163.MSBB

CP001163.MSBB        Location/Qualifiers
FT   CDS             74170..75201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="ECH74115_B0114"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279;
FT                   match to protein family HMM TIGR02208"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34445"
FT                   /protein_id="ACI34445.1"
FT                   /translation="MFSSAVRWPPGMVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFN
FT                   LTLCFPRYWMTWTGIGIICVFAMVPPALRDPLLGKLGMLVGRLGKSARQRALINLSLCF
FT                   PEYSDKEKENIVDAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKV
FT                   IFLVPHAWGVDIPAMLMAASGRKMAAMFHNQRNPVVDYVWNSVRRRFGGKLHARNDGIA
FT                   SFVRSVRQGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVY
FT                   DGKTHHLTIHVSPPLAIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEE
FT                   DPY"
     MFSSAVRWPP GMVPPSAVLC YHNEISRQIP VNMKNIRTEF IPRFNLTLCF PRYWMTWTGI        60
     GIICVFAMVP PALRDPLLGK LGMLVGRLGK SARQRALINL SLCFPEYSDK EKENIVDAMF       120
     ATASMAVVLM AELALSGPDK ISHRIRWNGL EIVEKMAQNN EKVIFLVPHA WGVDIPAMLM       180
     AASGRKMAAM FHNQRNPVVD YVWNSVRRRF GGKLHARNDG IASFVRSVRQ GYWGYYLPDQ       240
     DHGPEFSEFA DFFATYKATL PVIGRLSRIS GARIIPLFPV YDGKTHHLTI HVSPPLAIRQ       300
     KSDAHIARQI NEVVENFVRP HPEQYTWILK LLKTRKEGEE DPY                         343
//

If you have problems or comments...

PBIL Back to PBIL home page