(data stored in SCRATCH zone)

EMBL: CP001163.PE1

CP001163.PE1         Location/Qualifiers
FT   CDS             196..711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0017"
FT                   /product="hemolysin-activating lysine-acyltransferase HlyC"
FT                   /note="identified by match to protein family HMM PF02794"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34481"
FT                   /protein_id="ACI34481.1"
FT                   /translation="MKSNAFDVMGKVAWLWACSPLHKKWPLSVFAINVIPAIQTNQFAL
FT                   LIKDELPVAFCSWASLDLECEVKYINDVTSLYAKDWMSGERKWFIDWIAPFGHNMELYK
FT                   YMRKKYPYELFRAIRLDESSKTGKIAEFHGGGIDKKLASKIFRQYHHELMSEVKNRQDF
FT                   NFNIEKEN"
     MKSNAFDVMG KVAWLWACSP LHKKWPLSVF AINVIPAIQT NQFALLIKDE LPVAFCSWAS        60
     LDLECEVKYI NDVTSLYAKD WMSGERKWFI DWIAPFGHNM ELYKYMRKKY PYELFRAIRL       120
     DESSKTGKIA EFHGGGIDKK LASKIFRQYH HELMSEVKNR QDFNFNIEKE N                171
//

If you have problems or comments...

PBIL Back to PBIL home page