(data stored in SCRATCH zone)

EMBL: CP001163.PE105

CP001163.PE105       Location/Qualifiers
FT   CDS             91053..91565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0012"
FT                   /product="EtpM"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34512"
FT                   /protein_id="ACI34512.1"
FT                   /translation="MNELKKRLQYVSPRERRLLIGCVALLVVVFVYYVLWQPWLIREDK
FT                   WRTVVTREKNTVEWMKQQVPNIKRREASMPEQGEPLGLSAAVTRTSAAYGVSVTRLQPQ
FT                   GERLAVTLAPVEFNALMQWLTQLERRHRIRTMVFDVAAQGNPPGQVTVNRLVLSQDDVN
FT                   KDASLSR"
     MNELKKRLQY VSPRERRLLI GCVALLVVVF VYYVLWQPWL IREDKWRTVV TREKNTVEWM        60
     KQQVPNIKRR EASMPEQGEP LGLSAAVTRT SAAYGVSVTR LQPQGERLAV TLAPVEFNAL       120
     MQWLTQLERR HRIRTMVFDV AAQGNPPGQV TVNRLVLSQD DVNKDASLSR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page