(data stored in SCRATCH zone)

EMBL: CP001163.PE106

CP001163.PE106       Location/Qualifiers
FT   CDS             91632..92456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0013"
FT                   /product="bacterial Peptidase A24 N-domain protein"
FT                   /note="identified by match to protein family HMM PF01478;
FT                   match to protein family HMM PF06750"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34470"
FT                   /protein_id="ACI34470.1"
FT                   /translation="MPEFAVDYPLLWLICTGGLGGVTGSFLNVVIHRLPIMLERRWRRE
FT                   ALTLLAHSVPESGPAFNLMIPQSHCPCCFHPLGIRDNIPLLSYLFLKGKSRCCGERIPV
FT                   YYPLVEITNSVLFILAASRFPPGLTLAAAWLFISMLLVLAVIDCHTALLPDVLTLPLLW
FT                   LGLLFSLQRGVVTLEEAVVGAVSGYLCLWGLYWLFRFATGREGLGYGDFKLAAALGAWM
FT                   GWQALPSILLFASVSGLIVTVLLRIVTATDFTRPLPFGPWLALSGVCHFLLM"
     MPEFAVDYPL LWLICTGGLG GVTGSFLNVV IHRLPIMLER RWRREALTLL AHSVPESGPA        60
     FNLMIPQSHC PCCFHPLGIR DNIPLLSYLF LKGKSRCCGE RIPVYYPLVE ITNSVLFILA       120
     ASRFPPGLTL AAAWLFISML LVLAVIDCHT ALLPDVLTLP LLWLGLLFSL QRGVVTLEEA       180
     VVGAVSGYLC LWGLYWLFRF ATGREGLGYG DFKLAAALGA WMGWQALPSI LLFASVSGLI       240
     VTVLLRIVTA TDFTRPLPFG PWLALSGVCH FLLM                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page