(data stored in SCRATCH zone)

EMBL: CP001163.PE107

CP001163.PE107       Location/Qualifiers
FT   CDS             92551..92949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0014"
FT                   /product="EptO"
FT                   /note="identified by match to protein family HMM PF09691;
FT                   match to protein family HMM TIGR01004"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34432"
FT                   /protein_id="ACI34432.1"
FT                   /translation="MGNILKKLNCIASLLVLVTISGCHQSPSIHKQATVPPSEQLEQMA
FT                   SIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRLTRD
FT                   STPEYIKCREFNRRLVPFIGELLARGRG"
     MGNILKKLNC IASLLVLVTI SGCHQSPSIH KQATVPPSEQ LEQMASIVSA TRYLKMRCNR        60
     SDLPDEQSIL NVANRIAIGK GWQSLTQEDI RKHSDDIYVR LTRDSTPEYI KCREFNRRLV       120
     PFIGELLARG RG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page