(data stored in SCRATCH zone)

EMBL: CP001163.PE108

CP001163.PE108       Location/Qualifiers
FT   CDS             93128..93433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0015"
FT                   /product="IS911, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34477"
FT                   /protein_id="ACI34477.1"
FT                   /translation="MKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLSTMTRWVKQ
FT                   LRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATTALLMSDSLNSSR"
     MKKRNFSAEF KRESAQLVVD QNYTVADAAK AMDIGLSTMT RWVKQLRDER QGKTPKASPI        60
     TPEQIEIREL RKKLQRIEME NEILKKATTA LLMSDSLNSS R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page