(data stored in SCRATCH zone)

EMBL: CP001163.PE12

CP001163.PE12        Location/Qualifiers
FT   CDS             complement(11024..11644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34430"
FT                   /protein_id="ACI34430.1"
FT                   /translation="MRQERVLRIKAFRRALELGGGERADGCRHFPRWKTELRNFPHSSC
FT                   DLASNTLAYYLKERERCHPCIIFMEGNAGFHEAENSTVHGHVIVLLDGEYIDLTLDQFD
FT                   EYPDYIPYEPVESDGQIGKLLRNIMKHEDPVKTRQIDLDGGEELYAWLRDTADEVLAAD
FT                   PEWQARERSIEEAREAAITVFPFLSDVQKTECEQGPDSQEAAR"
     MRQERVLRIK AFRRALELGG GERADGCRHF PRWKTELRNF PHSSCDLASN TLAYYLKERE        60
     RCHPCIIFME GNAGFHEAEN STVHGHVIVL LDGEYIDLTL DQFDEYPDYI PYEPVESDGQ       120
     IGKLLRNIMK HEDPVKTRQI DLDGGEELYA WLRDTADEVL AADPEWQARE RSIEEAREAA       180
     ITVFPFLSDV QKTECEQGPD SQEAAR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page