(data stored in SCRATCH zone)

EMBL: CP001163.PE13

CP001163.PE13        Location/Qualifiers
FT   CDS             complement(11641..12099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34424"
FT                   /protein_id="ACI34424.1"
FT                   /translation="MRAFRARQREQATPLPPELAQLLTGQLGLLWQAAVKQAEAGALAA
FT                   REQADDDIARADKERDEALANVAALESELAVLREVVAERDRLLQEVRELRAEALPLREQ
FT                   VARLTATGEHLAAQLQDTKAELKEAREDGRQLQTELLALARQDGKVKK"
     MRAFRARQRE QATPLPPELA QLLTGQLGLL WQAAVKQAEA GALAAREQAD DDIARADKER        60
     DEALANVAAL ESELAVLREV VAERDRLLQE VRELRAEALP LREQVARLTA TGEHLAAQLQ       120
     DTKAELKEAR EDGRQLQTEL LALARQDGKV KK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page