(data stored in SCRATCH zone)

EMBL: CP001163.PE16

CP001163.PE16        Location/Qualifiers
FT   CDS             complement(13055..13942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0035"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34490"
FT                   /protein_id="ACI34490.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFSGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
     MPLLDKLREQ YGVGPVCSEL HIAPSTYYHC QQQRHHPDKR SARAQRDDWL KREIQRVYDE        60
     NHQVYGVRKV WRQLLREGIR VARCTVARLM AVMGLAGVLR GKKVRTTVSR KAVSAGDRVN       120
     RQFVAERPDQ LWVADFTYVS TWQGFVYVAF IIDVFSGCIV GWRVSSSMET TFVLDALEQA       180
     LWARRPSGTV HHSDKGSQYV SLAYTERLKE AKLLASTGST GDSYDNAMAE SINGLYKAEV       240
     IHRKSWKNRA EVELATLTWV DWYNNRRLLG RLGHIPPAEA EKAYYASIRN DDLAA            295
//

If you have problems or comments...

PBIL Back to PBIL home page