(data stored in SCRATCH zone)

EMBL: CP001163.PE17

CP001163.PE17        Location/Qualifiers
FT   CDS             complement(13942..14268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0036"
FT                   /product="IS629, transposase orfA"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34472"
FT                   /protein_id="ACI34472.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
     MTKNTRFSPE VRQRAVRMVL ESQGEYDSQW AAICSIAPKI GCTPETLRVW VRQHERDTGG        60
     GDGGLTTAER QRLKELEREN RELRRSNDIL RQASAYFAKA EFDRLWKK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page