(data stored in SCRATCH zone)

EMBL: CP001163.PE18

CP001163.PE18        Location/Qualifiers
FT   CDS             14367..14621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0037"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="identified by match to protein family HMM PF01845"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34440"
FT                   /protein_id="ACI34440.1"
FT                   /translation="MDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWR
FT                   MMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     MDVQSDIIDT PGRRMVIPLA SARLLSDKVS RELYPVVHIG DESWRMMTTD MASVPVSVIG        60
     EEVADLSHRE NDIKNAINLM FWGI                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page