(data stored in SCRATCH zone)

EMBL: CP001163.PE19

CP001163.PE19        Location/Qualifiers
FT   CDS             14622..15428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0038"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34500"
FT                   /protein_id="ACI34500.1"
FT                   /translation="MSGSVIHSQSAVMVPAVYSAGQPASLPVAIDYPAALALRQMSMVH
FT                   DELPKYLLAPEVSALLHYVPNLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQ
FT                   LATLKQRTEKAARTAGRMPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPMERRNRRTGR
FT                   TEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVL
FT                   QSLMGHKSISSKEVYTKVFALDVAARHRVQFAMPESDAVAMLKQLS"
     MSGSVIHSQS AVMVPAVYSA GQPASLPVAI DYPAALALRQ MSMVHDELPK YLLAPEVSAL        60
     LHYVPNLHRK MLLATLWNTG ARINEALALT RGDFSLAPPY PFVQLATLKQ RTEKAARTAG       120
     RMPAGQQTHR LVPLSDSWYV SQLQTMVATL KIPMERRNRR TGRTEKARIW EVTDRTVRTW       180
     IGEAVAAAAA DGVTFSVPVT PHTFRHSYAM HMLYAGIPLK VLQSLMGHKS ISSKEVYTKV       240
     FALDVAARHR VQFAMPESDA VAMLKQLS                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page