(data stored in SCRATCH zone)

EMBL: CP001163.PE2

CP001163.PE2         Location/Qualifiers
FT   CDS             713..3709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0018"
FT                   /product="RTX C-domain protein"
FT                   /note="identified by match to protein family HMM PF00353;
FT                   match to protein family HMM PF02382; match to protein
FT                   family HMM PF08339"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34487"
FT                   /protein_id="ACI34487.1"
FT                   /translation="MTVNKIKNIFNNATLTTKSAFNTASSSVRSAGKKLILLIPDNYEA
FT                   QGVGINELVKAADELGIEIHRTERDDTAIANQFFGAAEKVVGLTERGVAIFAPQLDKLL
FT                   QKYQKVGSKIGGTAENVGNNLGKAGTVLSALQNFTGIALSGMALDELLRKQRAGEDISQ
FT                   NDIAKSSIELINQLVDTVSSINSTVDSFSEQLNQLGSFLSSKPRLSSVGGKLQNLPDLG
FT                   PLGDGLDVVSGILSAVSASFILGNSDAHTGTKAAAGIELTTQVLGNVGKAVSQYILAQR
FT                   MAQGLSTTAASAGLITSAVMLAISPLSFLAAADKFERAKQLESYSERFKKLNYEGDALL
FT                   AAFHKETGAIDAALTTINTVLSSVSAGVSAASSASLIGAPISMLVSALTGTISGILEAS
FT                   KQAMFEHVAEKFAARINEWEKEHGKNYFENGYDARHAAFLEDSLSLLADFSRQHAVERA
FT                   VAITQQHWDEKIGELAGITRNADRSQSGKAYINYLENGGLLEAQPKEFTQQVFDPQKGT
FT                   IDLSTGNVSSVLTFITPTFTPGEEVRERKQSGKYEYMTSLIVNGKDTWSVKGIKNHKGV
FT                   YDYSKLIQFVEKNNKHYQARIISELGDKDDVVYSGAGSSEVFAGEGYDTVSYNKTDVGK
FT                   LTIDATGASKPGEYIVSKNMYGDVKVLQEVVKEQEVSVGKRTEKIQYRDFEFRTGGIPY
FT                   DVIDNLHSVEELIGGKHDDEFKGGKFNDIFHGADGNDYIEGNYGNDRLYGDDGDDYISG
FT                   GQGDDQLFGGSGNDKLSGGDGNNYLTGGSGNDELQAHGAYNILSGGTGDDKLYGGGGID
FT                   LLDGGEGNDYLNGGFGNDIYVYGQNYGHHTIADEGGKGDRLHLSDISFDDIAFKRVGND
FT                   LIMNKAINGVLSFNESNDVNGITFKNWFAKDASGADNHLVEVITDKDGREIKVDKIPHN
FT                   NNERSGYIKASNIASEKNMVNITSVANDINKIISSVSGFDSGDERLASLYNLSLHQNNT
FT                   HSTTLTTTV"
     MTVNKIKNIF NNATLTTKSA FNTASSSVRS AGKKLILLIP DNYEAQGVGI NELVKAADEL        60
     GIEIHRTERD DTAIANQFFG AAEKVVGLTE RGVAIFAPQL DKLLQKYQKV GSKIGGTAEN       120
     VGNNLGKAGT VLSALQNFTG IALSGMALDE LLRKQRAGED ISQNDIAKSS IELINQLVDT       180
     VSSINSTVDS FSEQLNQLGS FLSSKPRLSS VGGKLQNLPD LGPLGDGLDV VSGILSAVSA       240
     SFILGNSDAH TGTKAAAGIE LTTQVLGNVG KAVSQYILAQ RMAQGLSTTA ASAGLITSAV       300
     MLAISPLSFL AAADKFERAK QLESYSERFK KLNYEGDALL AAFHKETGAI DAALTTINTV       360
     LSSVSAGVSA ASSASLIGAP ISMLVSALTG TISGILEASK QAMFEHVAEK FAARINEWEK       420
     EHGKNYFENG YDARHAAFLE DSLSLLADFS RQHAVERAVA ITQQHWDEKI GELAGITRNA       480
     DRSQSGKAYI NYLENGGLLE AQPKEFTQQV FDPQKGTIDL STGNVSSVLT FITPTFTPGE       540
     EVRERKQSGK YEYMTSLIVN GKDTWSVKGI KNHKGVYDYS KLIQFVEKNN KHYQARIISE       600
     LGDKDDVVYS GAGSSEVFAG EGYDTVSYNK TDVGKLTIDA TGASKPGEYI VSKNMYGDVK       660
     VLQEVVKEQE VSVGKRTEKI QYRDFEFRTG GIPYDVIDNL HSVEELIGGK HDDEFKGGKF       720
     NDIFHGADGN DYIEGNYGND RLYGDDGDDY ISGGQGDDQL FGGSGNDKLS GGDGNNYLTG       780
     GSGNDELQAH GAYNILSGGT GDDKLYGGGG IDLLDGGEGN DYLNGGFGND IYVYGQNYGH       840
     HTIADEGGKG DRLHLSDISF DDIAFKRVGN DLIMNKAING VLSFNESNDV NGITFKNWFA       900
     KDASGADNHL VEVITDKDGR EIKVDKIPHN NNERSGYIKA SNIASEKNMV NITSVANDIN       960
     KIISSVSGFD SGDERLASLY NLSLHQNNTH STTLTTTV                               998
//

If you have problems or comments...

PBIL Back to PBIL home page