(data stored in SCRATCH zone)

EMBL: CP001163.PE20

CP001163.PE20        Location/Qualifiers
FT   CDS             15440..15562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0039"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34478"
FT                   /protein_id="ACI34478.1"
FT                   /translation="MAFIWKCGTEWICCFCLLNREAGCYPLRSERDSRENLPLS"
     MAFIWKCGTE WICCFCLLNR EAGCYPLRSE RDSRENLPLS                              40
//

If you have problems or comments...

PBIL Back to PBIL home page