(data stored in SCRATCH zone)

EMBL: CP001163.PE22

CP001163.PE22        Location/Qualifiers
FT   CDS             complement(16151..17038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0041"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34480"
FT                   /protein_id="ACI34480.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   HDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGGR
FT                   VSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
     MPLLDKLREQ YGVGPVCSEL HIAPSTYYHC QQQRHHPDKR SARAQHDDWL KREIQRVYDE        60
     NHQVYGVRKV WRQLLREGIR VARCTVARLM AVMGLAGVLR GKKVRTTISR KAVAAGDRVN       120
     RQFVAERPDQ LWVADFTYVS TWQGFVYVAF IIDVFAGYIV GGRVSSSMET TFVLDALEQA       180
     LWARRPSGTI HHSDKGSQYV SLAYTERLKE AGLLASTGST GDSYDNAMAE SINGLYKAEV       240
     IHRKSWKNRA EVELATLTWV DWYNNRRLLG RLGHTPPAEA EKAYYASIGN DDLAA            295
//

If you have problems or comments...

PBIL Back to PBIL home page