(data stored in SCRATCH zone)

EMBL: CP001163.PE24

CP001163.PE24        Location/Qualifiers
FT   CDS             complement(18675..18827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34427"
FT                   /protein_id="ACI34427.1"
FT                   /translation="MTSVYALVKCFHEFHSEHPLIIALHFFIKSCNLLQSNNKIAKSSK
FT                   NRKVV"
     MTSVYALVKC FHEFHSEHPL IIALHFFIKS CNLLQSNNKI AKSSKNRKVV                   50
//

If you have problems or comments...

PBIL Back to PBIL home page